Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rac [52595] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52596] (17 PDB entries) |
Domain d1foed_: 1foe D: [32009] Other proteins in same PDB: d1foea1, d1foea2, d1foec1, d1foec2, d1foee1, d1foee2, d1foeg1, d1foeg2 complexed with so4 |
PDB Entry: 1foe (more details), 2.8 Å
SCOPe Domain Sequences for d1foed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1foed_ c.37.1.8 (D:) Rac {Human (Homo sapiens) [TaxId: 9606]} mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl
Timeline for d1foed_: