Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) |
Family c.37.1.8: G proteins [52592] (20 proteins) |
Protein Rac [52595] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52596] (6 PDB entries) |
Domain d1foed_: 1foe D: [32009] Other proteins in same PDB: d1foea1, d1foea2, d1foec1, d1foec2, d1foee1, d1foee2, d1foeg1, d1foeg2 |
PDB Entry: 1foe (more details), 2.8 Å
SCOP Domain Sequences for d1foed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1foed_ c.37.1.8 (D:) Rac {Human (Homo sapiens)} mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl
Timeline for d1foed_: