Lineage for d5j43a_ (5j43 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907681Protein automated matches [190054] (13 species)
    not a true protein
  7. 2907693Species Escherichia coli [TaxId:83334] [320059] (2 PDB entries)
  8. 2907694Domain d5j43a_: 5j43 A: [320077]
    automated match to d1d6sa_

Details for d5j43a_

PDB Entry: 5j43 (more details), 2.7 Å

PDB Description: cdia-ct from uropathogenic escherichia coli in complex with cysk
PDB Compounds: (A:) Cysteine synthase A

SCOPe Domain Sequences for d5j43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j43a_ c.79.1.1 (A:) automated matches {Escherichia coli [TaxId: 83334]}
gkifednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
gvelveptsgntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasnpekylllqqfsnpanpeihekttgpeiwedtdgqvdvfiagvgtggt
ltgvsryikgtkgktdlisvaveptdspviaqalageeikpgphkiqgigagfipanldl
klvdkvigitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sgerylstalfad

SCOPe Domain Coordinates for d5j43a_:

Click to download the PDB-style file with coordinates for d5j43a_.
(The format of our PDB-style files is described here.)

Timeline for d5j43a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5j43e_