SCOPe 2.08: Domain d5j43a_: 5j43 A:

Lineage for d5j43a_ (5j43 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein automated matches [190054] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [320059] (2 PDB entries)

8. Domain d5j43a_: 5j43 A: [320077]
   automated match to d1d6sa_

Details for d5j43a_

PDB Entry: 5j43, 2.7 Å

PDB Description: cdia-ct from uropathogenic escherichia coli in complex with cysk

PDB Compounds: (A:) Cysteine synthase A

SCOPe Domain Sequences for d5j43a_:

Sequence; same for both SEQRES and ATOM records:

>d5j43a_ c.79.1.1 (A:) automated matches {Escherichia coli [TaxId: 83334]}
gkifednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
gvelveptsgntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasnpekylllqqfsnpanpeihekttgpeiwedtdgqvdvfiagvgtggt
ltgvsryikgtkgktdlisvaveptdspviaqalageeikpgphkiqgigagfipanldl
klvdkvigitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sgerylstalfad

Timeline for d5j43a_:

• d5j43a_ first appeared in SCOPe 2.06
  
• d5j43a_ appears in SCOPe 2.07