Lineage for d5j8qa1 (5j8q A:1-406)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2148529Species Bacillus subtilis [TaxId:224308] [320074] (2 PDB entries)
  8. 2148530Domain d5j8qa1: 5j8q A:1-406 [320075]
    Other proteins in same PDB: d5j8qa2
    automated match to d4lw2a_
    complexed with ala, plp

Details for d5j8qa1

PDB Entry: 5j8q (more details), 1.7 Å

PDB Description: crystal structure of the cysteine desulfurase sufs of bacillus subtilis
PDB Compounds: (A:) Cysteine desulfurase SufS

SCOPe Domain Sequences for d5j8qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j8qa1 c.67.1.0 (A:1-406) automated matches {Bacillus subtilis [TaxId: 224308]}
mnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvhtlg
tratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvityme
hhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtvnp
ikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkkal
lenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigldeis
rhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavraghh
caqplmkwldvtatarasfylynteeeidklvealqktkeyftnvf

SCOPe Domain Coordinates for d5j8qa1:

Click to download the PDB-style file with coordinates for d5j8qa1.
(The format of our PDB-style files is described here.)

Timeline for d5j8qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j8qa2