Lineage for d1e96a_ (1e96 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164253Protein Rac [52595] (1 species)
  7. 1164254Species Human (Homo sapiens) [TaxId:9606] [52596] (17 PDB entries)
  8. 1164269Domain d1e96a_: 1e96 A: [32007]
    Other proteins in same PDB: d1e96b_
    rac1
    complexed with gtp, mg

Details for d1e96a_

PDB Entry: 1e96 (more details), 2.4 Å

PDB Description: structure of the rac/p67phox complex
PDB Compounds: (A:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d1e96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e96a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}
pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
ledydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc

SCOPe Domain Coordinates for d1e96a_:

Click to download the PDB-style file with coordinates for d1e96a_.
(The format of our PDB-style files is described here.)

Timeline for d1e96a_: