SCOP 1.69: Domain d1e96a_: 1e96 A:

Lineage for d1e96a_ (1e96 A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (43 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (12 PDB entries)

8. Domain d1e96a_: 1e96 A: [32007]
   Other proteins in same PDB: d1e96b_
   rac1

Details for d1e96a_

PDB Entry: 1e96, 2.4 Å

PDB Description: structure of the rac/p67phox complex

SCOP Domain Sequences for d1e96a_:

Sequence; same for both SEQRES and ATOM records:

>d1e96a_ c.37.1.8 (A:) Rac {Human (Homo sapiens)}
pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
ledydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc

Timeline for d1e96a_:

• d1e96a_ first appeared (with stable ids) in SCOP 1.55
  
• d1e96a_ appears in SCOP 1.67
  
• d1e96a_ appears in SCOP 1.71
  
• d1e96a_ appears in the current release, SCOPe 2.08, called d1e96a1