![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (37 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rac [52595] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52596] (12 PDB entries) |
![]() | Domain d1e96a_: 1e96 A: [32007] Other proteins in same PDB: d1e96b_ rac1 complexed with gtp, mg; mutant |
PDB Entry: 1e96 (more details), 2.4 Å
SCOP Domain Sequences for d1e96a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e96a_ c.37.1.8 (A:) Rac {Human (Homo sapiens)} pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag ledydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
Timeline for d1e96a_: