Lineage for d1e96a1 (1e96 A:2-178)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867551Protein Rac [52595] (1 species)
  7. 2867552Species Human (Homo sapiens) [TaxId:9606] [52596] (41 PDB entries)
  8. 2867601Domain d1e96a1: 1e96 A:2-178 [32007]
    Other proteins in same PDB: d1e96a2, d1e96b_
    rac1
    complexed with gtp, mg

Details for d1e96a1

PDB Entry: 1e96 (more details), 2.4 Å

PDB Description: structure of the rac/p67phox complex
PDB Compounds: (A:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d1e96a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e96a1 c.37.1.8 (A:2-178) Rac {Human (Homo sapiens) [TaxId: 9606]}
qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagl
edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc

SCOPe Domain Coordinates for d1e96a1:

Click to download the PDB-style file with coordinates for d1e96a1.
(The format of our PDB-style files is described here.)

Timeline for d1e96a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e96a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1e96b_