Lineage for d5drfa_ (5drf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940227Species Aequorea coerulescens [TaxId:210840] [189267] (7 PDB entries)
  8. 2940230Domain d5drfa_: 5drf A: [320055]
    automated match to d3st2a_
    complexed with gol, na

Details for d5drfa_

PDB Entry: 5drf (more details), 1.14 Å

PDB Description: green/cyan wascfp-ph5.5 at ph 5.5
PDB Compounds: (A:) WasCFP-pH5.5 at pH 5.5

SCOPe Domain Sequences for d5drfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5drfa_ d.22.1.1 (A:) automated matches {Aequorea coerulescens [TaxId: 210840]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlk
ttltwgvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynaisgnvnitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqskqskdpnekrdhmvllefvtaagitl

SCOPe Domain Coordinates for d5drfa_:

Click to download the PDB-style file with coordinates for d5drfa_.
(The format of our PDB-style files is described here.)

Timeline for d5drfa_: