Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (19 species) not a true protein |
Species Aequorea coerulescens [TaxId:210840] [189267] (7 PDB entries) |
Domain d5drfa_: 5drf A: [320055] automated match to d3st2a_ complexed with gol, na |
PDB Entry: 5drf (more details), 1.14 Å
SCOPe Domain Sequences for d5drfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5drfa_ d.22.1.1 (A:) automated matches {Aequorea coerulescens [TaxId: 210840]} skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlk ttltwgvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn rielkgidfkedgnilghkleynaisgnvnitadkqkngikanfkirhniedgsvqladh yqqntpigdgpvllpdnhylstqskqskdpnekrdhmvllefvtaagitl
Timeline for d5drfa_: