SCOP 1.73: Domain d1g4ur_: 1g4u R:

Lineage for d1g4ur_ (1g4u R:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (16 PDB entries)

8. Domain d1g4ur_: 1g4u R: [32005]
   Other proteins in same PDB: d1g4us1, d1g4us2
   rac1 in complex with the GAP domain of SptP
   complexed with af3, gdp, mg; mutant

Details for d1g4ur_

PDB Entry: 1g4u, 2.3 Å

PDB Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp bound to rac1

PDB Compounds: (R:) ras-related c3 botulinum toxin substrate 1

SCOP Domain Sequences for d1g4ur_:

Sequence; same for both SEQRES and ATOM records:

>d1g4ur_ c.37.1.8 (R:) Rac {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp

Timeline for d1g4ur_:

• d1g4ur_ first appeared (with stable ids) in SCOP 1.55
  
• d1g4ur_ appears in SCOP 1.71
  
• d1g4ur_ appears in SCOP 1.75
  
• d1g4ur_ appears in the current release, SCOPe 2.08