Lineage for d1g4ur_ (1g4u R:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122077Protein Rac [52595] (1 species)
  7. 122078Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries)
  8. 122082Domain d1g4ur_: 1g4u R: [32005]
    Other proteins in same PDB: d1g4us1, d1g4us2

Details for d1g4ur_

PDB Entry: 1g4u (more details), 2.3 Å

PDB Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp bound to rac1

SCOP Domain Sequences for d1g4ur_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4ur_ c.37.1.8 (R:) Rac {Human (Homo sapiens)}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp

SCOP Domain Coordinates for d1g4ur_:

Click to download the PDB-style file with coordinates for d1g4ur_.
(The format of our PDB-style files is described here.)

Timeline for d1g4ur_: