Lineage for d5foib_ (5foi B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331924Species Micromonospora griseorubida [TaxId:28040] [226290] (10 PDB entries)
  8. 2331945Domain d5foib_: 5foi B: [320046]
    Other proteins in same PDB: d5foia2
    automated match to d4ubsa_
    complexed with gol, hem, my8, spd

Details for d5foib_

PDB Entry: 5foi (more details), 2.21 Å

PDB Description: crystal structure of mycinamicin viii c21 methyl hydroxylase mycci from micromonospora griseorubida bound to mycinamicin viii
PDB Compounds: (B:) mycinamicin viii c21 methyl hydroxylase

SCOPe Domain Sequences for d5foib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5foib_ a.104.1.0 (B:) automated matches {Micromonospora griseorubida [TaxId: 28040]}
mvvwpmdrtcawalpeqyaefrqratlvpakvwdgsptwlvsryehvrallvdprvtvdp
trqprlseadgdgdgfrsmlmldppehtrlrrmfisafsvrqvetmrpeiekivdgildr
llaleppvdilthlalpmstqvichllgvpyedreffqerselasrpnddrsmpalielv
eyldglvrtktahpdtgllgtavterllkgeithqelvnnavlllaaghetsanqvtlsv
ltllrhpetaaelreqpelmpnavdellryhsiadglrraatadivlgdhtiragdglii
llssanhdgntfgaeatfdihrparhhvafgygphqclgqnlarlemevtlgklfrrvpa
lrlaqepdalrvrqgspifgidellvew

SCOPe Domain Coordinates for d5foib_:

Click to download the PDB-style file with coordinates for d5foib_.
(The format of our PDB-style files is described here.)

Timeline for d5foib_: