SCOPe 2.08: Domain d5fxfa2: 5fxf A:239-526

Lineage for d5fxfa2 (5fxf A:239-526)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families)
   duplication: contains two subdomains of this fold

5. Family d.58.32.0: automated matches [227166] (1 protein)
   not a true family

6. Protein automated matches [226875] (6 species)
   not a true protein

7. Species Rhodococcus jostii [TaxId:101510] [319927] (4 PDB entries)

8. Domain d5fxfa2: 5fxf A:239-526 [320045]
   Other proteins in same PDB: d5fxfa1, d5fxfb1
   automated match to d1e0ya1
   complexed with bez, fad, gol

Details for d5fxfa2

PDB Entry: 5fxf, 1.9 Å

PDB Description: crystal structure of eugenol oxidase in complex with benzoate

PDB Compounds: (A:) eugenol oxidase

SCOPe Domain Sequences for d5fxfa2:

Sequence; same for both SEQRES and ATOM records:

>d5fxfa2 d.58.32.0 (A:239-526) automated matches {Rhodococcus jostii [TaxId: 101510]}
pasqsflitfdkeedleqivdimlplrinmaplqnvpvlrnifmdaaavskrtewfdgdg
pmpaeaiermkkdldlgfwnfygtlygpppliemyygmikeafgkipgarfftheerddr
gghvlqdrhkinngipsldelqlldwvpngghigfspvsapdgreamkqfemvrnraney
nkdyaaqfiiglremhhvclfiydtaipeareeilqmtkvlvreaaeagygeyrthnalm
ddvmatfnwgdgallkfhekikdaldpngiiapgksgiwsqrfrgqnl

Timeline for d5fxfa2:

• d5fxfa2 first appeared in SCOPe 2.06
  
• d5fxfa2 appears in SCOPe 2.07