SCOP 1.65: Domain d1he1d_: 1he1 D:

Lineage for d1he1d_ (1he1 D:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (35 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries)

8. Domain d1he1d_: 1he1 D: [32004]
   Other proteins in same PDB: d1he1a_, d1he1b_
   rac1 in complex with the GAP domain of ExoS
   complexed with af3, gdp, mg, ni

Details for d1he1d_

PDB Entry: 1he1, 2 Å

PDB Description: crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac

SCOP Domain Sequences for d1he1d_:

Sequence; same for both SEQRES and ATOM records:

>d1he1d_ c.37.1.8 (D:) Rac {Human (Homo sapiens)}
pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav

Timeline for d1he1d_:

• d1he1d_ first appeared (with stable ids) in SCOP 1.55
  
• d1he1d_ appears in SCOP 1.63
  
• d1he1d_ appears in SCOP 1.67
  
• d1he1d_ appears in the current release, SCOPe 2.08, called d1he1d1