SCOPe 2.06: Domain d5cvhb_: 5cvh B:

Lineage for d5cvhb_ (5cvh B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75559] (91 PDB entries)

8. Domain d5cvhb_: 5cvh B: [320030]
   automated match to d3wara_
   complexed with act, adp, i6p, mg

Details for d5cvhb_

PDB Entry: 5cvh, 1.85 Å

PDB Description: crystal structure of ck2alpha

PDB Compounds: (B:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d5cvhb_:

Sequence; same for both SEQRES and ATOM records:

>d5cvhb_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
pvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnne
kvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfkq
lyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyh
pgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlv
riakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldk
llrydhqsrltareamehpyfytv

Timeline for d5cvhb_:

• d5cvhb_ is new in SCOPe 2.06-stable
  
• d5cvhb_ appears in SCOPe 2.07
  
• d5cvhb_ appears in the current release, SCOPe 2.08