Lineage for d1he1c_ (1he1 C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484450Protein Rac [52595] (1 species)
  7. 484451Species Human (Homo sapiens) [TaxId:9606] [52596] (12 PDB entries)
  8. 484457Domain d1he1c_: 1he1 C: [32003]
    Other proteins in same PDB: d1he1a_, d1he1b_

Details for d1he1c_

PDB Entry: 1he1 (more details), 2 Å

PDB Description: crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac

SCOP Domain Sequences for d1he1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he1c_ c.37.1.8 (C:) Rac {Human (Homo sapiens)}
pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav

SCOP Domain Coordinates for d1he1c_:

Click to download the PDB-style file with coordinates for d1he1c_.
(The format of our PDB-style files is described here.)

Timeline for d1he1c_: