![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.32.0: automated matches [227166] (1 protein) not a true family |
![]() | Protein automated matches [226875] (3 species) not a true protein |
![]() | Species Rhodococcus jostii [TaxId:101510] [319927] (4 PDB entries) |
![]() | Domain d5fxpb2: 5fxp B:239-526 [320029] Other proteins in same PDB: d5fxpa1, d5fxpb1 automated match to d1e0ya1 complexed with fad, gol, v55 |
PDB Entry: 5fxp (more details), 2.6 Å
SCOPe Domain Sequences for d5fxpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fxpb2 d.58.32.0 (B:239-526) automated matches {Rhodococcus jostii [TaxId: 101510]} pasqsflitfdkeedleqivdimlplrinmaplqnvpvlrnifmdaaavskrtewfdgdg pmpaeaiermkkdldlgfwnfygtlygpppliemyygmikeafgkipgarfftheerddr gghvlqdrhkinngipsldelqlldwvpngghigfspvsapdgreamkqfemvrnraney nkdyaaqfiiglremhhvclfiydtaipeareeilqmtkvlvreaaeagygeyrthnalm ddvmatfnwgdgallkfhekikdaldpngiiapgksgiwsqrfrgqnl
Timeline for d5fxpb2: