Lineage for d5fxpb2 (5fxp B:239-526)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198038Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2198145Family d.58.32.0: automated matches [227166] (1 protein)
    not a true family
  6. 2198146Protein automated matches [226875] (3 species)
    not a true protein
  7. 2198160Species Rhodococcus jostii [TaxId:101510] [319927] (4 PDB entries)
  8. 2198168Domain d5fxpb2: 5fxp B:239-526 [320029]
    Other proteins in same PDB: d5fxpa1, d5fxpb1
    automated match to d1e0ya1
    complexed with fad, gol, v55

Details for d5fxpb2

PDB Entry: 5fxp (more details), 2.6 Å

PDB Description: crystal structure of eugenol oxidase in complex with vanillin
PDB Compounds: (B:) eugenol oxidase

SCOPe Domain Sequences for d5fxpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fxpb2 d.58.32.0 (B:239-526) automated matches {Rhodococcus jostii [TaxId: 101510]}
pasqsflitfdkeedleqivdimlplrinmaplqnvpvlrnifmdaaavskrtewfdgdg
pmpaeaiermkkdldlgfwnfygtlygpppliemyygmikeafgkipgarfftheerddr
gghvlqdrhkinngipsldelqlldwvpngghigfspvsapdgreamkqfemvrnraney
nkdyaaqfiiglremhhvclfiydtaipeareeilqmtkvlvreaaeagygeyrthnalm
ddvmatfnwgdgallkfhekikdaldpngiiapgksgiwsqrfrgqnl

SCOPe Domain Coordinates for d5fxpb2:

Click to download the PDB-style file with coordinates for d5fxpb2.
(The format of our PDB-style files is described here.)

Timeline for d5fxpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fxpb1