Lineage for d5hbac_ (5hba C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777698Species Zebrafish (Danio rerio) [TaxId:7955] [260723] (2 PDB entries)
  8. 2777702Domain d5hbac_: 5hba C: [320022]
    automated match to d2wnvb_
    complexed with so4

Details for d5hbac_

PDB Entry: 5hba (more details), 2.05 Å

PDB Description: globular domain of zebrafish complement 1qa protein
PDB Compounds: (C:) Uncharacterized protein

SCOPe Domain Sequences for d5hbac_:

Sequence, based on SEQRES records: (download)

>d5hbac_ b.22.1.0 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
kpafsvlrnetsqaqykqpvtfndklsdanddfqiktgyftckvpgvyyfvfhassegrl
clrlkstsappvslsfcdfnsksvslvvsggavltllkgdkvwiepfagdggvgqmpkrl
yavfngfliyrn

Sequence, based on observed residues (ATOM records): (download)

>d5hbac_ b.22.1.0 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
kpafsvlrnetsqaqykqpvtfndklsdanddfqiktgyftckvpgvyyfvfhassegrl
clrlkstsappvslsfcdfnsksvslvvsggavltllkgdkvwiepfagmpkrlyavfng
fliyrn

SCOPe Domain Coordinates for d5hbac_:

Click to download the PDB-style file with coordinates for d5hbac_.
(The format of our PDB-style files is described here.)

Timeline for d5hbac_: