Lineage for d5clgb_ (5clg B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116261Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2116262Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
    automatically mapped to Pfam PF00731
  6. 2116312Protein automated matches [191111] (3 species)
    not a true protein
  7. 2116313Species Acetobacter aceti [TaxId:1457393] [311949] (18 PDB entries)
  8. 2116333Domain d5clgb_: 5clg B: [320021]
    automated match to d1u11b_
    complexed with cit; mutant

Details for d5clgb_

PDB Entry: 5clg (more details), 1.85 Å

PDB Description: structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) mutant h59n from the acidophilic bacterium acetobacter aceti, at ph 5.4
PDB Compounds: (B:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d5clgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5clgb_ c.23.8.1 (B:) automated matches {Acetobacter aceti [TaxId: 1457393]}
sapvvgiimgsqsdwetmrhadallteleiphetlivsanrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletwralqtasvpnspit

SCOPe Domain Coordinates for d5clgb_:

Click to download the PDB-style file with coordinates for d5clgb_.
(The format of our PDB-style files is described here.)

Timeline for d5clgb_: