SCOP 1.67: Domain d1mh1__: 1mh1 -

Lineage for d1mh1__ (1mh1 -)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (37 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (12 PDB entries)

8. Domain d1mh1__: 1mh1 - [32002]
   rac1
   complexed with gnp, mg; mutant

Details for d1mh1__

PDB Entry: 1mh1, 1.38 Å

PDB Description: small g-protein

SCOP Domain Sequences for d1mh1__:

Sequence; same for both SEQRES and ATOM records:

>d1mh1__ c.37.1.8 (-) Rac {Human (Homo sapiens)}
gspqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
agqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkld
lrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
ppp

Timeline for d1mh1__:

• d1mh1__ first appeared (with stable ids) in SCOP 1.55
  
• d1mh1__ appears in SCOP 1.65
  
• d1mh1__ appears in SCOP 1.69
  
• d1mh1__ appears in the current release, SCOPe 2.08, called d1mh1a_