Lineage for d1mh1__ (1mh1 -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393753Family c.37.1.8: G proteins [52592] (37 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 394025Protein Rac [52595] (1 species)
  7. 394026Species Human (Homo sapiens) [TaxId:9606] [52596] (12 PDB entries)
  8. 394027Domain d1mh1__: 1mh1 - [32002]
    rac1
    complexed with gnp, mg; mutant

Details for d1mh1__

PDB Entry: 1mh1 (more details), 1.38 Å

PDB Description: small g-protein

SCOP Domain Sequences for d1mh1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mh1__ c.37.1.8 (-) Rac {Human (Homo sapiens)}
gspqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
agqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkld
lrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
ppp

SCOP Domain Coordinates for d1mh1__:

Click to download the PDB-style file with coordinates for d1mh1__.
(The format of our PDB-style files is described here.)

Timeline for d1mh1__: