Lineage for d1mh1__ (1mh1 -)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179429Family c.37.1.8: G proteins [52592] (26 proteins)
  6. 179616Protein Rac [52595] (1 species)
  7. 179617Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries)
  8. 179618Domain d1mh1__: 1mh1 - [32002]

Details for d1mh1__

PDB Entry: 1mh1 (more details), 1.38 Å

PDB Description: small g-protein

SCOP Domain Sequences for d1mh1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mh1__ c.37.1.8 (-) Rac {Human (Homo sapiens)}
gspqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
agqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkld
lrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
ppp

SCOP Domain Coordinates for d1mh1__:

Click to download the PDB-style file with coordinates for d1mh1__.
(The format of our PDB-style files is described here.)

Timeline for d1mh1__: