Lineage for d1mh1__ (1mh1 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Rac [52595] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52596] (6 PDB entries) 
Domain d1mh1__: 1mh1 - [32002]
Details for d1mh1__
PDB Entry: 1mh1 (more details), 1.38 Å
PDB Description: small g-protein
SCOP Domain Sequences for d1mh1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mh1__ c.37.1.8 (-) Rac {Human (Homo sapiens)}
gspqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
agqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkld
lrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
ppp
SCOP Domain Coordinates for d1mh1__:
Click to download the PDB-style file with coordinates for d1mh1__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mh1__:
- d1mh1__ appears in SCOP 1.57
- d1mh1__ appears in the current release, SCOPe 2.08, called d1mh1a_
View in 3D