Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) duplication: contains two subdomains of this fold |
Family d.58.32.0: automated matches [227166] (1 protein) not a true family |
Protein automated matches [226875] (3 species) not a true protein |
Species Rhodococcus jostii [TaxId:101510] [319927] (4 PDB entries) |
Domain d5fxfb2: 5fxf B:239-526 [319995] Other proteins in same PDB: d5fxfa1, d5fxfb1 automated match to d1e0ya1 complexed with bez, fad, gol |
PDB Entry: 5fxf (more details), 1.9 Å
SCOPe Domain Sequences for d5fxfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fxfb2 d.58.32.0 (B:239-526) automated matches {Rhodococcus jostii [TaxId: 101510]} pasqsflitfdkeedleqivdimlplrinmaplqnvpvlrnifmdaaavskrtewfdgdg pmpaeaiermkkdldlgfwnfygtlygpppliemyygmikeafgkipgarfftheerddr gghvlqdrhkinngipsldelqlldwvpngghigfspvsapdgreamkqfemvrnraney nkdyaaqfiiglremhhvclfiydtaipeareeilqmtkvlvreaaeagygeyrthnalm ddvmatfnwgdgallkfhekikdaldpngiiapgksgiwsqrfrgqnl
Timeline for d5fxfb2: