Lineage for d5fxfb1 (5fxf B:2-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987703Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2987704Protein automated matches [191143] (13 species)
    not a true protein
  7. 2987754Species Rhodococcus jostii [TaxId:101510] [319925] (4 PDB entries)
  8. 2987758Domain d5fxfb1: 5fxf B:2-238 [319994]
    Other proteins in same PDB: d5fxfa2, d5fxfb2
    automated match to d1e0ya2
    complexed with bez, fad, gol

Details for d5fxfb1

PDB Entry: 5fxf (more details), 1.9 Å

PDB Description: crystal structure of eugenol oxidase in complex with benzoate
PDB Compounds: (B:) eugenol oxidase

SCOPe Domain Sequences for d5fxfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fxfb1 d.145.1.0 (B:2-238) automated matches {Rhodococcus jostii [TaxId: 101510]}
trtlppgvsderfdaalqrfrdvvgdkwvlstadeleafrdpypvgaaeanlpsavvspe
steqvqdivrianeygiplspvstgknngyggaaprlsgsvivktgermnrilevnekyg
yallepgvtyfdlyeylqshdsglmldcpdlgwgsvvgntldrgvgytpygdhfmwqtgl
evvlpqgevmrtgmgalpgsdawqlfpygfgpfpdgmftqsnlgivtkmgialmqrp

SCOPe Domain Coordinates for d5fxfb1:

Click to download the PDB-style file with coordinates for d5fxfb1.
(The format of our PDB-style files is described here.)

Timeline for d5fxfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fxfb2