| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Helicobacter pylori [TaxId:85963] [188967] (2 PDB entries) |
| Domain d5c6fd1: 5c6f D:1-166 [319982] Other proteins in same PDB: d5c6fa2, d5c6fb2, d5c6fc2, d5c6fd2, d5c6fe2, d5c6ff2, d5c6fg2, d5c6fh2, d5c6fi2, d5c6fj2, d5c6fk2, d5c6fl2 automated match to d1krqa_ complexed with fe, imd; mutant |
PDB Entry: 5c6f (more details), 2 Å
SCOPe Domain Sequences for d5c6fd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c6fd1 a.25.1.1 (D:1-166) automated matches {Helicobacter pylori [TaxId: 85963]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif
lnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdhatfnfl
qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d5c6fd1: