SCOPe 2.01: Domain d1plla_: 1pll A:

Lineage for d1plla_ (1pll A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (84 PDB entries)
   Uniprot Q6P716

8. Domain d1plla_: 1pll A: [31997]
   complexed with gdp

Details for d1plla_

PDB Entry: 1pll, 2.8 Å

PDB Description: crystallographic studies on p21h-ras using synchrotron laue method: improvement of crystal quality and monitoring of the gtpase reaction at different time points

PDB Compounds: (A:) c-h-ras p21 protein

SCOPe Domain Sequences for d1plla_:

Sequence, based on SEQRES records:

>d1plla_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Sequence, based on observed residues (ATOM records):

>d1plla_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
ysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaar
tvesrqaqdlarsygiyietsaktrqgvedafytlvreirqh

Timeline for d1plla_:

• d1plla_ first appeared (with stable ids) in SCOP 1.55, called d1pll__
  
• d1plla_ appears in SCOP 1.75
  
• d1plla_ appears in SCOPe 2.02
  
• d1plla_ appears in the current release, SCOPe 2.08