SCOP 1.55: Domain d1pll__: 1pll -

Lineage for d1pll__ (1pll -)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families)

5. Family c.37.1.8: G proteins [52592] (20 proteins)

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (33 PDB entries)

8. Domain d1pll__: 1pll - [31997]

Details for d1pll__

PDB Entry: 1pll, 2.8 Å

PDB Description: crystallographic studies on p21h-ras using synchrotron laue method: improvement of crystal quality and monitoring of the gtpase reaction at different time points

SCOP Domain Sequences for d1pll__:

Sequence, based on SEQRES records:

>d1pll__ c.37.1.8 (-) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Sequence, based on observed residues (ATOM records):

>d1pll__ c.37.1.8 (-) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
ysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaar
tvesrqaqdlarsygiyietsaktrqgvedafytlvreirqh

Timeline for d1pll__:

• d1pll__ appears in SCOP 1.57
  
• d1pll__ appears in the current release, SCOPe 2.08, called d1plla_