SCOPe 2.07: Domain d5g0ia1: 5g0i A:58-419

Lineage for d5g0ia1 (5g0i A:58-419)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.0: automated matches [191435] (1 protein)
   not a true family

6. Protein automated matches [190626] (12 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [319911] (53 PDB entries)

8. Domain d5g0ia1: 5g0i A:58-419 [319962]
   automated match to d3c10c_
   complexed with cl, edo, k, n4r, zn

Details for d5g0ia1

PDB Entry: 5g0i, 1.99 Å

PDB Description: crystal structure of danio rerio hdac6 cd1 and cd2 (linker cleaved) in complex with nexturastat a

PDB Compounds: (A:) hdac6

SCOPe Domain Sequences for d5g0ia1:

Sequence; same for both SEQRES and ATOM records:

>d5g0ia1 c.42.1.0 (A:58-419) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
skatgtglvyvdaftrfhclwdashpecparvstvmemletegllgrcvqvearavtede
lllvhtkeyvelmkstqnmteeelktlaekydsvylhpgffssaclsvgsvlqlvdkvmt
sqlrngfsinrppghhaqadkmngfcmfnnlaiaaryaqkrhrvqrvlivdwdvhhgqgi
qyifeedpsvlyfsvhryedgsfwphlkesdsssvgsgagqgyninlpwnkvgmesgdyi
tafqqlllpvayefqpqlvlvaagfdavigdpkggmqvspecfsilthmlkgvaqgrlvl
aleggynlqstaegvcasmrsllgdpcphlpssgapcesalksisktisdlypfwkslqt
fe

Timeline for d5g0ia1:

• d5g0ia1 first appeared in SCOPe 2.06
  
• d5g0ia1 appears in the current release, SCOPe 2.08