SCOPe 2.08: Domain d5fuxa2: 5fux A:339-384

Lineage for d5fuxa2 (5fux A:339-384)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (9 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319948] (4 PDB entries)

8. Domain d5fuxa2: 5fux A:339-384 [319957]
   Other proteins in same PDB: d5fuxa1, d5fuxb1
   automated match to d1xbta2
   complexed with mg, po4, qbt, zn

Details for d5fuxa2

PDB Entry: 5fux, 2.2 Å

PDB Description: catalytic domain of thymidine kinase from trypanosoma brucei with dtmp

PDB Compounds: (A:) thymdine kinase

SCOPe Domain Sequences for d5fuxa2:

Sequence; same for both SEQRES and ATOM records:

>d5fuxa2 g.39.1.0 (A:339-384) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
avcmechnrkasftyrtvksderklvggsdmymsvcrscyetkrnm

Timeline for d5fuxa2:

• d5fuxa2 first appeared in SCOPe 2.06
  
• d5fuxa2 appears in SCOPe 2.07