Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319946] (4 PDB entries) |
Domain d5fuxa1: 5fux A:203-338 [319956] Other proteins in same PDB: d5fuxa2, d5fuxb2 automated match to d1xbta1 complexed with mg, po4, qbt, zn |
PDB Entry: 5fux (more details), 2.2 Å
SCOPe Domain Sequences for d5fuxa1:
Sequence, based on SEQRES records: (download)
>d5fuxa1 c.37.1.0 (A:203-338) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} ahgrieliigpmfagkttelmrrvqrhkhaqrscyiikytgdtrysegaitshdqralta nvsvsnlhdvgdewrkydviavdegqffpdvaafcskaadsgkvvivsaldadylqepfe eicllvsradsvvkls
>d5fuxa1 c.37.1.0 (A:203-338) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} ahgrieliigpmfagkttelmrrvqrhkhaqrscyiikytgdtltanvsvsnlhdvgdew rkydviavdegqffpdvaafcskaadsgkvvivsaldadylqepfeeicllvsradsvvk ls
Timeline for d5fuxa1: