![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (30 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85963] [188967] (2 PDB entries) |
![]() | Domain d5c6fb1: 5c6f B:1-166 [319953] Other proteins in same PDB: d5c6fa2, d5c6fb2, d5c6fc2, d5c6fd2, d5c6fe2, d5c6ff2, d5c6fg2, d5c6fh2, d5c6fi2, d5c6fj2, d5c6fk2, d5c6fl2 automated match to d1krqa_ complexed with fe, imd; mutant |
PDB Entry: 5c6f (more details), 2 Å
SCOPe Domain Sequences for d5c6fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c6fb1 a.25.1.1 (B:1-166) automated matches {Helicobacter pylori [TaxId: 85963]} mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif lnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdhatfnfl qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d5c6fb1: