![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein cH-p21 Ras protein [52593] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52594] (116 PDB entries) Uniprot Q6P716 |
![]() | Domain d1he8b_: 1he8 B: [31995] Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a3, d1he8a4 complexed with gnp, mg |
PDB Entry: 1he8 (more details), 3 Å
SCOPe Domain Sequences for d1he8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1he8b_ c.37.1.8 (B:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
Timeline for d1he8b_:
![]() Domains from other chains: (mouse over for more information) d1he8a1, d1he8a2, d1he8a3, d1he8a4 |