Lineage for d1he8b_ (1he8 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 581928Protein cH-p21 Ras protein [52593] (1 species)
  7. 581929Species Human (Homo sapiens) [TaxId:9606] [52594] (47 PDB entries)
  8. 581975Domain d1he8b_: 1he8 B: [31995]
    Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a3, d1he8a4
    complexed with gnp, mg; mutant

Details for d1he8b_

PDB Entry: 1he8 (more details), 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex
PDB Compounds: (B:)

SCOP Domain Sequences for d1he8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he8b_ c.37.1.8 (B:) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOP Domain Coordinates for d1he8b_:

Click to download the PDB-style file with coordinates for d1he8b_.
(The format of our PDB-style files is described here.)

Timeline for d1he8b_: