SCOP 1.57: Domain d1he8b_: 1he8 B:

Lineage for d1he8b_ (1he8 B:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.8: G proteins [52592] (20 proteins)

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (34 PDB entries)

8. Domain d1he8b_: 1he8 B: [31995]
   Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a3, d1he8a4

Details for d1he8b_

PDB Entry: 1he8, 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex

SCOP Domain Sequences for d1he8b_:

Sequence; same for both SEQRES and ATOM records:

>d1he8b_ c.37.1.8 (B:) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d1he8b_:

• d1he8b_ first appeared (with stable ids) in SCOP 1.55
  
• d1he8b_ appears in SCOP 1.59
  
• d1he8b_ appears in the current release, SCOPe 2.08