Lineage for d5fuyd2 (5fuy D:339-382)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3036144Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 3036145Protein automated matches [190463] (9 species)
    not a true protein
  7. 3036225Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319948] (4 PDB entries)
  8. 3036235Domain d5fuyd2: 5fuy D:339-382 [319949]
    Other proteins in same PDB: d5fuya1, d5fuyb1, d5fuyc1, d5fuyd1, d5fuye1, d5fuye3, d5fuyf1
    automated match to d1xbta2
    complexed with po4, qbt, zn

Details for d5fuyd2

PDB Entry: 5fuy (more details), 2.8 Å

PDB Description: catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
PDB Compounds: (D:) thymdine kinase

SCOPe Domain Sequences for d5fuyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fuyd2 g.39.1.0 (D:339-382) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
avcmechnrkasftyrtvksderklvggsdmymsvcrscyetkr

SCOPe Domain Coordinates for d5fuyd2:

Click to download the PDB-style file with coordinates for d5fuyd2.
(The format of our PDB-style files is described here.)

Timeline for d5fuyd2: