Lineage for d5dqba1 (5dqb A:2-231)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940227Species Aequorea coerulescens [TaxId:210840] [189267] (7 PDB entries)
  8. 2940232Domain d5dqba1: 5dqb A:2-231 [319945]
    Other proteins in same PDB: d5dqba2
    automated match to d3st2a_
    complexed with gol, na

Details for d5dqba1

PDB Entry: 5dqb (more details), 1.25 Å

PDB Description: green/cyan wascfp at ph 8.0
PDB Compounds: (A:) WasCFP_pH2

SCOPe Domain Sequences for d5dqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dqba1 d.22.1.1 (A:2-231) automated matches {Aequorea coerulescens [TaxId: 210840]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlk
ttltwgvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynaisgnvnitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqskqskdpnekrdhmvllefvtaagitl

SCOPe Domain Coordinates for d5dqba1:

Click to download the PDB-style file with coordinates for d5dqba1.
(The format of our PDB-style files is described here.)

Timeline for d5dqba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dqba2