Lineage for d5dqba1 (5dqb A:2-231)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) 
Protein automated matches [190406] (19 species)
not a true protein
Species Aequorea coerulescens [TaxId:210840] [189267] (7 PDB entries) 
Domain d5dqba1: 5dqb A:2-231 [319945]
Other proteins in same PDB: d5dqba2
automated match to d3st2a_
complexed with gol, na
Details for d5dqba1
PDB Entry: 5dqb (more details), 1.25 Å
PDB Description: green/cyan wascfp at ph 8.0
PDB Compounds: (A:) WasCFP_pH2SCOPe Domain Sequences for d5dqba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dqba1 d.22.1.1 (A:2-231) automated matches {Aequorea coerulescens [TaxId: 210840]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlk
ttltwgvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynaisgnvnitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqskqskdpnekrdhmvllefvtaagitl
SCOPe Domain Coordinates for d5dqba1:
Click to download the PDB-style file with coordinates for d5dqba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5dqba1:
- d5dqba1 first appeared in SCOPe 2.06, called d5dqba_
- d5dqba1 appears in SCOPe 2.07
View in 3D
