Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) |
Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) automatically mapped to Pfam PF00576 |
Protein Transthyretin (synonym: prealbumin) [49474] (5 species) sandwich; 8 strands in 2 sheets |
Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries) Uniprot P02766 31-143 |
Domain d5cm1a_: 5cm1 A: [319944] automated match to d1ttaa_ mutant |
PDB Entry: 5cm1 (more details), 1.22 Å
SCOPe Domain Sequences for d5cm1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cm1a_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]} cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtnp
Timeline for d5cm1a_: