SCOPe 2.06: Domain d5brcg1: 5brc G:2-152

Lineage for d5brcg1 (5brc G:2-152)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (4 families)
Family b.33.1.0: automated matches [191455] (1 protein)
not a true family
Protein automated matches [190701] (11 species)
not a true protein
Species Diaphorobacter sp. [TaxId:1302548] [319937] (3 PDB entries)
Domain d5brcg1: 5brc G:2-152 [319938]
Other proteins in same PDB: d5brca2, d5brcc_, d5brcd2, d5brcf_, d5brcg2, d5brci_
automated match to d1o7na1
complexed with fe, fes

Details for d5brcg1

PDB Entry: 5brc (more details), 2.9 Å

PDB Description: oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2

PDB Compounds: (G:) 3NT oxygenase alpha subunit

SCOPe Domain Sequences for d5brcg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5brcg1 b.33.1.0 (G:2-152) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
syqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmglde
vivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfekel
ygdaikkkclglkevpriesfhgfiygcfda

SCOPe Domain Coordinates for d5brcg1:

Click to download the PDB-style file with coordinates for d5brcg1.
(The format of our PDB-style files is described here.)

Timeline for d5brcg1: