Lineage for d5fxea1 (5fxe A:2-238)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2593699Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2593700Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2593943Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2593944Protein automated matches [191143] (12 species)
    not a true protein
  7. 2593994Species Rhodococcus jostii [TaxId:101510] [319925] (4 PDB entries)
  8. 2593999Domain d5fxea1: 5fxe A:2-238 [319935]
    Other proteins in same PDB: d5fxea2, d5fxeb2
    automated match to d1e0ya2
    complexed with ciy, fad, gol

Details for d5fxea1

PDB Entry: 5fxe (more details), 1.9 Å

PDB Description: crystal structure of eugenol oxidase in complex with coniferyl alcohol
PDB Compounds: (A:) eugenol oxidase

SCOPe Domain Sequences for d5fxea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fxea1 d.145.1.0 (A:2-238) automated matches {Rhodococcus jostii [TaxId: 101510]}
trtlppgvsderfdaalqrfrdvvgdkwvlstadeleafrdpypvgaaeanlpsavvspe
steqvqdivrianeygiplspvstgknngyggaaprlsgsvivktgermnrilevnekyg
yallepgvtyfdlyeylqshdsglmldcpdlgwgsvvgntldrgvgytpygdhfmwqtgl
evvlpqgevmrtgmgalpgsdawqlfpygfgpfpdgmftqsnlgivtkmgialmqrp

SCOPe Domain Coordinates for d5fxea1:

Click to download the PDB-style file with coordinates for d5fxea1.
(The format of our PDB-style files is described here.)

Timeline for d5fxea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fxea2