Lineage for d5ddha2 (5ddh A:182-274)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2746845Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2746911Domain d5ddha2: 5ddh A:182-274 [319932]
    Other proteins in same PDB: d5ddha1, d5ddhb_
    automated match to d1s9wa1
    complexed with gol

Details for d5ddha2

PDB Entry: 5ddh (more details), 1.5 Å

PDB Description: structure of hla-a2:01 with the 12-mer peptide f12k
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d5ddha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ddha2 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

SCOPe Domain Coordinates for d5ddha2:

Click to download the PDB-style file with coordinates for d5ddha2.
(The format of our PDB-style files is described here.)

Timeline for d5ddha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ddha1
View in 3D
Domains from other chains:
(mouse over for more information)
d5ddhb_