Lineage for d5fxeb2 (5fxe B:239-526)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955209Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955316Family d.58.32.0: automated matches [227166] (1 protein)
    not a true family
  6. 2955317Protein automated matches [226875] (6 species)
    not a true protein
  7. 2955339Species Rhodococcus jostii [TaxId:101510] [319927] (4 PDB entries)
  8. 2955345Domain d5fxeb2: 5fxe B:239-526 [319928]
    Other proteins in same PDB: d5fxea1, d5fxeb1
    automated match to d1e0ya1
    complexed with ciy, fad, gol

Details for d5fxeb2

PDB Entry: 5fxe (more details), 1.9 Å

PDB Description: crystal structure of eugenol oxidase in complex with coniferyl alcohol
PDB Compounds: (B:) eugenol oxidase

SCOPe Domain Sequences for d5fxeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fxeb2 d.58.32.0 (B:239-526) automated matches {Rhodococcus jostii [TaxId: 101510]}
pasqsflitfdkeedleqivdimlplrinmaplqnvpvlrnifmdaaavskrtewfdgdg
pmpaeaiermkkdldlgfwnfygtlygpppliemyygmikeafgkipgarfftheerddr
gghvlqdrhkinngipsldelqlldwvpngghigfspvsapdgreamkqfemvrnraney
nkdyaaqfiiglremhhvclfiydtaipeareeilqmtkvlvreaaeagygeyrthnalm
ddvmatfnwgdgallkfhekikdaldpngiiapgksgiwsqrfrgqnl

SCOPe Domain Coordinates for d5fxeb2:

Click to download the PDB-style file with coordinates for d5fxeb2.
(The format of our PDB-style files is described here.)

Timeline for d5fxeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fxeb1