Lineage for d5c6ff1 (5c6f F:1-166)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990371Protein automated matches [190041] (27 species)
    not a true protein
  7. 1990613Species Helicobacter pylori [TaxId:85963] [188967] (2 PDB entries)
  8. 1990625Domain d5c6ff1: 5c6f F:1-166 [319907]
    Other proteins in same PDB: d5c6fa2, d5c6fb2, d5c6fc2, d5c6fd2, d5c6fe2, d5c6ff2, d5c6fg2, d5c6fh2, d5c6fi2, d5c6fj2, d5c6fk2, d5c6fl2
    automated match to d1krqa_
    complexed with fe, imd; mutant

Details for d5c6ff1

PDB Entry: 5c6f (more details), 2 Å

PDB Description: crystal structures of ferritin mutants reveal side-on binding to diiron and end-on cleavage of oxygen
PDB Compounds: (F:) Bacterial non-heme ferritin

SCOPe Domain Sequences for d5c6ff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c6ff1 a.25.1.1 (F:1-166) automated matches {Helicobacter pylori [TaxId: 85963]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif
lnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdhatfnfl
qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOPe Domain Coordinates for d5c6ff1:

Click to download the PDB-style file with coordinates for d5c6ff1.
(The format of our PDB-style files is described here.)

Timeline for d5c6ff1: