Lineage for d5cu6a_ (5cu6 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589005Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2589006Species Human (Homo sapiens) [TaxId:9606] [75559] (180 PDB entries)
  8. 2589025Domain d5cu6a_: 5cu6 A: [319901]
    automated match to d2pvra_
    complexed with act, atp

Details for d5cu6a_

PDB Entry: 5cu6 (more details), 1.36 Å

PDB Description: crystal structure of ck2alpha
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d5cu6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cu6a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvaaakikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy
hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql
vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
kllrydhqsrltareamehpyfytvvk

SCOPe Domain Coordinates for d5cu6a_:

Click to download the PDB-style file with coordinates for d5cu6a_.
(The format of our PDB-style files is described here.)

Timeline for d5cu6a_: