SCOPe 2.06: Domain d5clia_: 5cli A:

Lineage for d5clia_ (5cli A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families)

5. Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
   automatically mapped to Pfam PF00731

6. Protein automated matches [191111] (3 species)
   not a true protein

7. Species Acetobacter aceti [TaxId:1457393] [311949] (18 PDB entries)

8. Domain d5clia_: 5cli A: [319892]
   automated match to d1u11b_
   complexed with air

Details for d5clia_

PDB Entry: 5cli, 1.95 Å

PDB Description: structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium acetobacter aceti, complexed with air (5-aminoimidazole ribonucleotide)

PDB Compounds: (A:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d5clia_:

Sequence; same for both SEQRES and ATOM records:

>d5clia_ c.23.8.1 (A:) automated matches {Acetobacter aceti [TaxId: 1457393]}
sapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletwralqtasvpnspit

Timeline for d5clia_:

• d5clia_ is new in SCOPe 2.06-stable
  
• d5clia_ appears in SCOPe 2.07
  
• d5clia_ appears in the current release, SCOPe 2.08