Lineage for d5la6e_ (5la6 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016286Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2016485Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2016486Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2016487Protein Stathmin 4 [101496] (1 species)
  7. 2016488Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (72 PDB entries)
  8. 2016511Domain d5la6e_: 5la6 E: [319876]
    Other proteins in same PDB: d5la6a1, d5la6a2, d5la6b1, d5la6b2, d5la6c1, d5la6c2, d5la6d1, d5la6d2, d5la6f1, d5la6f2, d5la6f3
    automated match to d4i55e_
    complexed with acp, ca, gdp, gtp, mg, x3h

Details for d5la6e_

PDB Entry: 5la6 (more details), 2.1 Å

PDB Description: tubulin-pironetin complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5la6e_:

Sequence, based on SEQRES records: (download)

>d5la6e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d5la6e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d5la6e_:

Click to download the PDB-style file with coordinates for d5la6e_.
(The format of our PDB-style files is described here.)

Timeline for d5la6e_: