SCOPe 2.08: Domain d5l8kb1: 5l8k B:1-104

Lineage for d5l8kb1 (5l8k B:1-104)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (9 PDB entries)

8. Domain d5l8kb1: 5l8k B:1-104 [319870]
   Other proteins in same PDB: d5l8ka_, d5l8kb2
   automated match to d2coqa_
   complexed with adp, edo, so4

Details for d5l8kb1

PDB Entry: 5l8k, 1.79 Å

PDB Description: aurora-a kinase domain in complex with vnar-d01 (crystal form 2)

PDB Compounds: (B:) new antigen receptor variable domain

SCOPe Domain Sequences for d5l8kb1:

Sequence; same for both SEQRES and ATOM records:

>d5l8kb1 b.1.1.1 (B:1-104) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
marvdqtpriatketgesltincvlrdtacaldstnwyrtklgstkeqtisiggrysetv
degsnsasltirdlrvedsgtykckaidscwlsregagtvltvk

Timeline for d5l8kb1:

• d5l8kb1 first appeared in SCOPe 2.06
  
• d5l8kb1 appears in SCOPe 2.07