Lineage for d5l8la_ (5l8l A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2586292Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 2586293Species Human (Homo sapiens) [TaxId:9606] [90039] (72 PDB entries)
  8. 2586295Domain d5l8la_: 5l8l A: [319861]
    Other proteins in same PDB: d5l8lb1, d5l8lb2
    automated match to d4tl0a_
    complexed with adp, edo, so4

Details for d5l8la_

PDB Entry: 5l8l (more details), 1.67 Å

PDB Description: aurora-a kinase domain in complex with vnar-d01 (crystal form 1)
PDB Compounds: (A:) Aurora kinase A

SCOPe Domain Sequences for d5l8la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l8la_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlagtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitanssk

SCOPe Domain Coordinates for d5l8la_:

Click to download the PDB-style file with coordinates for d5l8la_.
(The format of our PDB-style files is described here.)

Timeline for d5l8la_: