SCOP 1.69: Domain d2q21__: 2q21 -

Lineage for d2q21__ (2q21 -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (43 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (46 PDB entries)

8. Domain d2q21__: 2q21 - [31986]

Details for d2q21__

PDB Entry: 2q21, 2.2 Å

PDB Description: crystal structures at 2.2 angstroms resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with gsp

SCOP Domain Sequences for d2q21__:

Sequence; same for both SEQRES and ATOM records:

>d2q21__ c.37.1.8 (-) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqhklrkl

Timeline for d2q21__:

• d2q21__ first appeared (with stable ids) in SCOP 1.55
  
• d2q21__ appears in SCOP 1.67
  
• d2q21__ appears in SCOP 1.71
  
• d2q21__ appears in the current release, SCOPe 2.08, called d2q21a_