| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (2 families) ![]() automatically mapped to Pfam PF02203 |
| Family a.24.2.0: automated matches [254222] (1 protein) not a true family |
| Protein automated matches [254505] (3 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [319821] (3 PDB entries) |
| Domain d4z9jb_: 4z9j B: [319859] automated match to d2d4ub_ |
PDB Entry: 4z9j (more details), 1.78 Å
SCOPe Domain Sequences for d4z9jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z9jb_ a.24.2.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
sqksfvvsnqlreqqgeltstwdlmlqtrinlsrsavrmmmdssnqqsnakvelldsark
tlaqaathykkfksmaplpemvatsrnidekyknyytaltelidyldygntgayfaqptq
gmqnamgeafaqyalsseklyrdivtdnaddyrfaqwq
Timeline for d4z9jb_: