SCOPe 2.06: Domain d5la6b1: 5la6 B:2-245

Lineage for d5la6b1 (5la6 B:2-245)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (48 PDB entries)

8. Domain d5la6b1: 5la6 B:2-245 [319854]
   Other proteins in same PDB: d5la6a2, d5la6b2, d5la6c2, d5la6d2, d5la6e_, d5la6f1, d5la6f2, d5la6f3
   automated match to d4drxb1
   complexed with acp, ca, gdp, gtp, mg, x3h

Details for d5la6b1

PDB Entry: 5la6, 2.1 Å

PDB Description: tubulin-pironetin complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5la6b1:

Sequence; same for both SEQRES and ATOM records:

>d5la6b1 c.32.1.1 (B:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d5la6b1:

• d5la6b1 is new in SCOPe 2.06-stable
  
• d5la6b1 appears in SCOPe 2.07
  
• d5la6b1 appears in the current release, SCOPe 2.08